Web stats for Sedlakinteriors - sedlakinteriors.com
Sedlak Interiors Cleveland Furniture Store servicing Solon, Cleveland, Canton, Medina, Akron, Youngstown, Ohio furniture stores has a great selection of living room, bedroom, dining room, home office, entertainment, accent tables, mattresses and more.
2.00 Rating by ClearWebStats
sedlakinteriors.com is 2 decades 5 years 1 month old. This website has a #2,889,415 rank in global traffic. It has a .com as an domain extension. This website has a Google PageRank of 2 out of 10. This domain is estimated value of $ 240.00 and has a daily earning of $ 1.00. It is also listed in Dmoz. While no active threats were reported recently by users, sedlakinteriors.com is SAFE to browse.
Traffic Report of Sedlakinteriors
Daily Unique Visitors: | 167 |
Daily Pageviews: | 334 |
Estimated Valuation
Income Per Day: | $ 1.00 |
Estimated Worth: | $ 240.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | 1 |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | 5 |
Alexa BackLinks: | 12 |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Good |
WOT Privacy: | Good |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank
PR 2 out of 10
PageSpeed Score
66
Siteadvisor Rating
Not Applicable
Where is sedlakinteriors.com server located?
Social Engagement
Facebook Shares: | 13 |
Facebook Likes: | 5 |
Facebook Comments: | 9 |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 6 |
H3 Headings: | 5 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | 1 | Total Images: | 37 |
Google Adsense: | Not Applicable | Google Analytics: | UA-30610956-1 |
Websites Hosted on Same IP (i.e. 96.127.148.2)
Ken Tool - A Leader in Automotive Aftermarket Tire Repair Tools - Home
- kentool.com
A Leader in Automotive Aftermarket Tire Repair Tools
Polymer Packaging | Flexible Packaging Products
- polymerpkg.com
The Polymer Packaging family of companies provide flexible packaging solutions for flexible films, pouches and bags.
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 09 Jun 2014 23:26:00 GMT
Server: Apache/2.2.26 (Unix) mod_ssl/2.2.26 OpenSSL/0.9.8e-fips-rhel5 mod_auth_passthrough/2.1 mod_bwlimited/1.4 FrontPage/5.0.2.2635 PHP/5.2.17
X-Powered-By: PHP/5.2.17
Transfer-Encoding: chunked
Content-Type: text/html
Status-Code: 200
Status: 200 OK
Date: Mon, 09 Jun 2014 23:26:00 GMT
Server: Apache/2.2.26 (Unix) mod_ssl/2.2.26 OpenSSL/0.9.8e-fips-rhel5 mod_auth_passthrough/2.1 mod_bwlimited/1.4 FrontPage/5.0.2.2635 PHP/5.2.17
X-Powered-By: PHP/5.2.17
Transfer-Encoding: chunked
Content-Type: text/html
Domain Information for sedlakinteriors.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
sedlakinteriors.com | A | 14384 |
IP:96.127.148.2 |
sedlakinteriors.com | NS | 86400 |
Target:ns1.crowlsite.com |
sedlakinteriors.com | NS | 86400 |
Target:ns2.crowlsite.com |
sedlakinteriors.com | SOA | 86400 |
MNAME:ns1.crowlsite.com RNAME:dweidleman.crowlinc.com Serial:2013040301 Refresh:86400 Retry:7200 Expire:3600000 |
sedlakinteriors.com | MX | 14400 |
Target:mail.sedlakinteriors.com |
Similarly Ranked Websites to Sedlakinteriors
PDF Software | thefreepdfreader.com
- thefreepdfreader.com
Download PDF Software free from thefreepdfreader. Safe, recommended, editor-reviewed software files for your PC computer.
99 Jeevesway Digital Marketing Services – Digital Marketing Services | Local Business
- 99jeeveswaydigitalmarketingservices.com
Plastic Surgery Utah - The Best Cosmetic Surgeon In Salt Lake City
- surface-med.com
Utah plastic Surgeons Dr. Barson and staff provide Utah with plastic surgery options for residents throughout Utah & Salt Lake City. Discover the best